PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_7757.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 268aa    MW: 29759 Da    PI: 6.9424
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_7757.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM136.51.7e-4241361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                  lppG+rF Pt+eelv +yL++ ++g++  ++e+vi+ +d+++++Pw+Lp+    +++++ + w++F+ r++++a+g r++r+t sgyWka g+   v+
  MLOC_7757.1   4 LPPGYRFYPTEEELVRFYLRHMLDGSRrDDIERVIPVADVCSLDPWQLPEvhrgACAGHGEPWFYFCARQEREARGGRPSRTTPSGYWKAAGTPGLVY 101
                  79**********************9996677788**************95456544557889************************************ PP

          NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  s++g+ vg+kkt+vfy+grap g kt+W m+eyr+
  MLOC_7757.1 102 SAGGHPVGTKKTMVFYRGRAPAGAKTKWKMNEYRA 136
                  *********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-482168IPR003441NAC domain
PROSITE profilePS5100547.1434169IPR003441NAC domain
PfamPF023651.4E-225135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MAELPPGYRF YPTEEELVRF YLRHMLDGSR RDDIERVIPV ADVCSLDPWQ LPEVHRGACA  60
GHGEPWFYFC ARQEREARGG RPSRTTPSGY WKAAGTPGLV YSAGGHPVGT KKTMVFYRGR  120
APAGAKTKWK MNEYRAFDDD GTHADAAAPA PNTTLEVRSE FSLCRLYTRS GSLRQFDRRP  180
CTAVAGSGAE DPASSSAAAA SANEVFEMGR GQKRKRHAAN DHAPSNGDAY RSVVQQQQQQ  240
EVVGGADEQL TADDMTDWAE LLHWIEYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-30417217168NAC domain-containing protein 19
4dul_A4e-30417217168NAC domain-containing protein 19
1ut7_B4e-30417217168NO APICAL MERISTEM PROTEIN
1ut7_A4e-30417217168NO APICAL MERISTEM PROTEIN
1ut4_B4e-30417217168NO APICAL MERISTEM PROTEIN
1ut4_A4e-30417217168NO APICAL MERISTEM PROTEIN
3swp_D5e-30417220171NAC domain-containing protein 19
3swp_C5e-30417220171NAC domain-containing protein 19
3swp_B5e-30417220171NAC domain-containing protein 19
3swp_A5e-30417220171NAC domain-containing protein 19
3swm_D5e-30417220171NAC domain-containing protein 19
3swm_C5e-30417220171NAC domain-containing protein 19
3swm_B5e-30417220171NAC domain-containing protein 19
3swm_A5e-30417220171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3599540.0AK359954.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1107F05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568356.11e-121PREDICTED: NAC domain-containing protein 90-like isoform X1
SwissprotQ9FMR33e-66NAC90_ARATH; NAC domain-containing protein 90
TrEMBLF2D7U20.0F2D7U2_HORVD; Predicted protein
STRINGMLOC_7757.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.15e-67NAC domain containing protein 90